Scientists Discover That Fasting Triggers Stem Cell Regeneration & Fights Cancer

316792 views

❌ Invalid or missing YouTube ID.

Scientists Discover That Fasting Triggers Stem Cell Regeneration & Fights Cancer

A number of ancient health practices are proving to be effective in multiple ways. We recently posted an article about meditation, and how neuroscience can now explain what happens to the brain when we meditate. Now, scientists have discovered the first evidence of a natural intervention triggering stem cell-based regeneration of an organ or system. The study was published in the June 5 issue of Cell Stem Cell by researchers from the University of Southern California. The research shows that cycles of prolonged fasting protect against immune system damage and induce immune system regeneration. They concluded that fasting shifts stem cells from a dormant state to a state of self-renewal. 
 
Human clinical trials were conducted using patients who were receiving chemotherapy. For long periods of time, patients did not eat which significantly lowered their white blood cell counts. In mice, fasting cycles “flipped a regenerative switch, changing the signalling pathways for hematopoietic stem cells, which are responsible for the generation of blood and immune systems.”  

“We could not predict that prolonged fasting would have such a remarkable effect in promoting stem cell-based regeneration of the heatopoietic system. When you starve, the system tries to save energy, and one of the things it can do to save energy is to recycle a lot of the immune cells that are not needed, especially those that may be damaged.  What we started noticing in both our human work and animal work is that the white blood cell count goes down with prolonged fasting. Then when you re-feed, the blood cells come back. ” – Valter Longo, corresponding author. (1)

Again, because fasting significantly lowers white blood cell counts, this triggers stem cell-based regeneration of new immune system cells.  More importantly, it reduces the PKA enzyme, which has been linked to aging, tumour progression and cancer.(1) It’s also noteworthy to mention that fasting protected against toxicity in a pilot clinical trial where patients fasted for 72 hours prior to chemotherapy.

“Chemotherapy causes significant collateral damage to the immune system. The results of this study suggest that fasting may mitigate some of the harmful effects of chemotherapy.” Co-Author Tanya Dorff   

Fasting is a tradition that’s been incorporated into many ancient cultures, from Vedic to Buddhist and more, fasting should not be confused with starvation. It’s the process of restrain and control from the sensorial experience of eating and at the same time making sure you are doing it correctly. When I fast, I usually do water fasts and I have been doing them for almost eight years now and I always feel great and full of energy after doing so.

More Research

1. Fasting helps protect against brain disease:

Researchers at the National Institute on Aging in Baltimore have found evidence that fasting for one or two days a week can prevent the effects of Alzheimer and Parkinson’s disease. Research also found that cutting the daily intake to 500 calories a day for two days out of the seven can show clear beneficial effects for the brain.

2. Fasting cuts your risk of heart disease and diabetes:

Regularly going a day without food reduces your risk of heart disease and diabetes. Studies show that fasting releases a significant surge in human growth hormone, which is associated with speeding up metabolism and burning off fat. Shedding fat is known to cut the risk of heart disease and diabetes. Doctors are even starting to consider fasting as a treatment.

3. Fasting effectively treats cancer in human cells:

A study from the scientific journal of aging found that cancer patients who included fasting into their therapy perceived fewer side effects from chemotherapy. All tests conducted so far show that fasting improves survival, slow tumor growth and limit the spread of tumors. The National Institute on Aging has also studied one type of breast cancer in detail to further understand the effects of fasting on cancer. As a result of fasting, the cancer cells tried to make new proteins and took other steps to keep growing and dividing. As a result of these steps, which in turn led to a number of other steps, damaging free radical molecules were created which broke down the cancer cells own DNA and caused their destruction! It’s cellular suicide, the cancer cell is trying to replace all of the stuff missing in the bloodstream that it needs to survive after a period of fasting, but can’t. In turn, it tries to create them and this leads to its own destruction

Again, make sure you do your research before trying this out. Hopefully this can kick start you further into looking into it if you are truly interested.

A number of ancient health practices are proving to be effective in multiple ways. We recently posted an article about meditation, and how neuroscience can now explain what happens to the brain when we meditate. Now, scientists have discovered the first evidence of a natural intervention triggering stem cell-based regeneration of an organ or system. The study was published in the June 5 issue of Cell Stem Cell by researchers from the University of Southern California. The research shows that cycles of prolonged fasting protect against immune system damage and induce immune system regeneration. They concluded that fasting shifts stem cells from a dormant state to a state of self-renewal. 
 
Human clinical trials were conducted using patients who were receiving chemotherapy. For long periods of time, patients did not eat which significantly lowered their white blood cell counts. In mice, fasting cycles “flipped a regenerative switch, changing the signalling pathways for hematopoietic stem cells, which are responsible for the generation of blood and immune systems.”  

“We could not predict that prolonged fasting would have such a remarkable effect in promoting stem cell-based regeneration of the heatopoietic system. When you starve, the system tries to save energy, and one of the things it can do to save energy is to recycle a lot of the immune cells that are not needed, especially those that may be damaged.  What we started noticing in both our human work and animal work is that the white blood cell count goes down with prolonged fasting. Then when you re-feed, the blood cells come back. ” – Valter Longo, corresponding author. (1)

Again, because fasting significantly lowers white blood cell counts, this triggers stem cell-based regeneration of new immune system cells.  More importantly, it reduces the PKA enzyme, which has been linked to aging, tumour progression and cancer.(1) It’s also noteworthy to mention that fasting protected against toxicity in a pilot clinical trial where patients fasted for 72 hours prior to chemotherapy.

“Chemotherapy causes significant collateral damage to the immune system. The results of this study suggest that fasting may mitigate some of the harmful effects of chemotherapy.” Co-Author Tanya Dorff   

Fasting is a tradition that’s been incorporated into many ancient cultures, from Vedic to Buddhist and more, fasting should not be confused with starvation. It’s the process of restrain and control from the sensorial experience of eating and at the same time making sure you are doing it correctly. When I fast, I usually do water fasts and I have been doing them for almost eight years now and I always feel great and full of energy after doing so.

More Research

1. Fasting helps protect against brain disease:

Researchers at the National Institute on Aging in Baltimore have found evidence that fasting for one or two days a week can prevent the effects of Alzheimer and Parkinson’s disease. Research also found that cutting the daily intake to 500 calories a day for two days out of the seven can show clear beneficial effects for the brain.

2. Fasting cuts your risk of heart disease and diabetes:

Regularly going a day without food reduces your risk of heart disease and diabetes. Studies show that fasting releases a significant surge in human growth hormone, which is associated with speeding up metabolism and burning off fat. Shedding fat is known to cut the risk of heart disease and diabetes. Doctors are even starting to consider fasting as a treatment.

3. Fasting effectively treats cancer in human cells:

A study from the scientific journal of aging found that cancer patients who included fasting into their therapy perceived fewer side effects from chemotherapy. All tests conducted so far show that fasting improves survival, slow tumor growth and limit the spread of tumors. The National Institute on Aging has also studied one type of breast cancer in detail to further understand the effects of fasting on cancer. As a result of fasting, the cancer cells tried to make new proteins and took other steps to keep growing and dividing. As a result of these steps, which in turn led to a number of other steps, damaging free radical molecules were created which broke down the cancer cells own DNA and caused their destruction! It’s cellular suicide, the cancer cell is trying to replace all of the stuff missing in the bloodstream that it needs to survive after a period of fasting, but can’t. In turn, it tries to create them and this leads to its own destruction

Again, make sure you do your research before trying this out. Hopefully this can kick start you further into looking into it if you are truly interested.

Legalisir SuratidncashMOKONDO BABIslot pulsaslot gacorslot onlineslot88ransplaytipsmahjong waysMISTER PISANG SNIPPET MARIKITALIATkemenagkabjombangartikel rumah limasan jawapaket midnight telkomsel termurah 2025 berselancar di mahjong ways tanpa hambatanundang investor dan publisher game global jelajahi potensi gim tanah air buat game semacam game terkenal mahjong wayspaket kuota telkomsel 2025 untuk gaming main mahjong ways tanpa kendalaspesifikasi dan harga vivo y400 di indonesia mulai rp 3 jutaan lancar jalankan mahjongpixel 10 jadi hp pertama dengan fitur wa atau video call via satelit untuk dapat menangkan mahjonghp realme p4 dan p4 pro resmi meluncur dengan baterai7000 mah tahan lama main mahjong sehariankuota game mahjong ways xl vs telkomsel mana lebih cepatpaket internet telkomsel terbaru solusi murah main mahjongredmi note 15 pro tawarkan performa tinggi untuk main mahjong ways dengan harga terjangkaurog xbox ally segera rilis di indonesia ini spesifikasi dan fitur unggulannya yang mampu jalankan permainan mahjong 120 fpsrekomendasi kuota internet murah 2025 untuk game mahjong ways harianmain mahjong ways bebas hambatan pakai xl atau axis mana lebih baikpaket kuota gaming 2025 untuk mahjong ways mana yang lebih murahkuota internet game mahjong tanpa fup xl telkomsel indosatcara pakai kuota anti hangus buat pengguna telkomsel agar lancar main mahjong wayskuota gaming telkomsel support 4g dan 5g main mahjong ways semakin menyenangkaninilah paket kuota game mahjong termurah dari axis tri telkomsel xlharga kuota internet main mahjong ways dari semua provider indonesiatelkomsel nyalakan semangat indonesia di game mahjong waystips pilih kuota xl atau axis untuk game mahjong waysideal untuk belajar dan bermain mahjong ways inilah tablet dibawah 6 jutahadirkan reno14 series oppo jadi magnet anak muda di lalala festival 2025 buat main mahjonghp vivo t4 pro dengan snapdragon 7 gen4 jadi dapur pacu andalan taklukan mahjongmain mahjong ways pakai kuota indosat hemat dan stabilpengalaman main mahjong ways dengan kuota paket xlpaket midnight telkomsel untuk main mahjong wayspaket tri untuk main mahjong dengan kuota gaming harianadu paket gaming mahjong termurah telkomsel vs xl vs indosatkuota mahjong ways telkomsel xl indosat bulan ini5 fitur ai di hp samsung fold 7 yang mampu bantu pecahkan pola mahjongManfaatkan Fitur Demo Mode Buat Belajar Pola Mahjong Ways Sebelum Main BeneranWaktu Terbaik Main Mahjong Ways - Jam Pagi atau Malam? Ini AnalisisnyaHindari Main Mahjong Ways Pakai Data Saat Hujan - Sinyal Bisa Tidak StabilCara Clear Cache Mahjong Ways Biar Nggak Lemot - Bersihin Data Sampah Tiap MingguCara Baca RTP Mahjong Ways - Cek Persentase Kemenangan di Info Gamecerita driver ojol yang colong charger di rest area demi lanjut main mahjong waysinovasi layar hp transparan masa depan baru untuk game mahjong wayshp tahan air 10 meter main mahjong ways sambil berenangtile penghubung hati kisah ibu dan anak yang kembali akrab berkat mahjong wayskakek penjaga kuburan yang menemukan cahaya dari dunia maya dan mahjong wayssamsung galaxy ai fitur game booster khusus untuk analisis pola tile mahjong waysiphone 16 pro chip a18 bionic dengan neural engine terdepan untuk render grafis mahjong ways 120 fpsxiaomi hyperos optimasi sistem level kernel untuk pengalaman mahjong ways tanpa laginfinix zero 30 5g memory expansion technology hingga 21gb untuk multitasking saat main mahjong wayslenovo legion phone 3 dual battery 6000mah untuk mahjong ways nonstop 12 jamqualcomm rilis chip snapdragon w 5 gen 2 dan w 5 plus gen 2 jalankan mahjong tanpa lagbukti xiaomi redmi note 15 dan redmi note 15 pro plus siap masuk indonesia untuk dipakai main mahjongAnalisis RTP Hari Ini Peluang Menang Lebih Tinggi di Mahjong Ways pada Periode IniBukti Nyata Pemain Ini Menang 100x Lipat Modal di Mahjong Ways dalam 1 JamKonten Unik Kreatif Rahasia Viral dengan Tema Mahjong WaysPrediksi Pola Tile Hari Ini Kombinasi yang Akan Sering Muncul di Mahjong WaysPrediksi Trend Mahjong Ways 2025 Fitur Baru dan Peluang Emasvivo x100 pro chip mediatek dimensity 9300 dengan ai gaming engine untuk optimasi mahjong wayspoco f6 pro layar crystalres 15k dan dolby vision untuk detail tile mahjong ways yang jernihtelkomsel 5g jaringan ultra cepat untuk pengalaman bermain mahjong ways tanpa lagxl axiata jaringan 45g pro dengan teknologi carrier aggregation untuk mahjong ways di daerah terpencilindosat ooredoo hutchison teknologi 5g priority untuk stabilitas koneksi selama turnamen mahjong wayssensasi pecahkan pola scatter mahjong dengan lenovo legion go 2 intip spesifikasi dan jadwal rilismain spaceman dalam air tes ketahanan vivo y500 yang tahan air dan baterai jumbomahjong tanpa kendala dengan xiaomi poco c85 kembaran redmi 15c miliki baterai 6000 mahsweet bonanza hadirkan gameplay mulus di tecno spark slim dan tecno pova slim layar amoled curved 144hzmahjong wins 2 100000 x tahan lama pakai realme 15t hp 3 jutaan dengan baterai monsterKode Alam Kupu-Kupu Masuk Rumah Simbol Keberuntungan dalam Mencari Tile SpesialKode Alam Hujan Deras Pertanda Fitur Free Spin Akan Aktif di Mahjong WaysKode Alam Mimpi Bertemu Ular Pertanda Akan Mendapatkan Bonus Besar di Mahjong WaysHKode Alam Mimpi Berenang Pertanda Kemenangan Beruntun di Mahjong WaysTangan Kanan Gatal Pertanda Akan Menerima Bonus atau Jackpot di Mahjong WaysHidung Gatal Tanda Fitur Free Spin Akan Segera Aktif di Mahjong WaysTelapak Kaki Gatal Isyarat untuk Mengubah Strategi Bermain Mahjong WaysJantung Berdebar Kencang Pertanda Kemenangan Beruntun di Mahjong Waysgreat rhino jadi puas pakai galaxy tab s11 ultra begini bocoran lengkapnyapantau 5 lions megaways dengan hp lipat vivo x fold5 layar lipat pertama dari vendor ponsel asal chinamain lucky neko tanpa khawatir dengan oppo a6 max hp tipis dengan baterai tahan lamabagikan jam emas spaceman lewat quick share lihat tampilan baru rilisan google mirip oneui 8 samsungstarlight princess tetap aman didukung infinix hot 60 pro plus begini penampakan hp enteng tipis iniArea yang Pernah Membawa Kenangan Berhasil Memanfaatkan Energi Positif Masa Lalu untuk Mahjong WaysRuangan dengan Elemen Kayu Pertumbuhan dan Ekspansi Keberuntungan dalam Mahjong WaysBatu Giok Hijau Pembawa Energi Positif dan Kemakmuran dalam Bermain Mahjong WaysKue Lapis Legit Simbol Lapisan Keberuntungan dalam Mahjong WaysFokus Memicu Fitur Bonus di Mahjong Ways Kunci Kemenangan BesarPola Mahjong Black Scatter 5 Shio Beruntung 4 September 2025 Lupakan Logika Ramalan Shio 4 September 2025 Pola Aneh Ramalan Gen Z Shio Ular Menyala Punya Uang 100Juta Ramalan Keuangan 6 Shio Besok 5 September 2025 Rahasia RTP Mahjong Ways Peluang Besar Shio Kuda Kaya PGSoft Pola Ramalan Orang Pintar Ramalan Nostradamus Terungkap Pesan Kuno Mahjong Ways Bukan Sembarang Shio Kelinci Dapatkan Kemenangan Rabbit Garden Ramalan Cina Lengkap Orang Terpilih Mahjong Scatter Hitam Shio Kerbau Gong Kemenangan Shio Monyet Memanjat Pilar Kemenangan Mahjong Ways Rahasia Kepribadian Shio Babi Malas Tapi Dapat Uang Ganesha Fortune Teknologi Kamera HP Terbaru yang Bikin Detail Tile Mahjong Ways Makin Tajam Saat Direkam untuk Konten StreamingRahasia Kode Alam Melihat Burung Hantu Malam Hari sebagai Tanda Kemenangan di Mahjong WaysKode Alam Kehilangan Sandal di Jalan Jadi Pertanda Rezeki Tak Terduga dari Mahjong WaysKode Alam Mimpi Naik Kereta Malam Jadi Simbol Rezeki Mengalir Deras di Wild Banditokode alam dibalik kejatuhan cicak kejutan terkait hokikode alam mitos atau fakta dan pengaruh di kehidupantafsir mimpi ramalan angka hubungan 4d 3d 2dkode alam ayam bertelur simbol keberkahan kesuburanlihat waktu yang tepat taklukan mahjong gunakan huawei watch gt 6 seriesinilah cara main gates of olympus di rog xbox ally yang segera dijual di indonesiabocoran spaceman di hp oppo yang dapat coloros15 tambah lancar mainkan game favoritdukung mahjong ways 2 samsung keluarkan galaxy a07 hp murah looks mewah dengan brightness tinggimain starlight princess lancar di honor x7d tahan jatuh tanpa takut rusak saat bermainDari Dapur ke Layar Ponsel Kisah Chef Muda yang Menemukan Inspirasi Strategi Mahjong Ways dari Seni Meracik ResepKode Alam: Melihat Ular Hijau dan Tanda Keberuntungan di Mahjong Ways
InsidersListsThe East Corner CompanyECIL IndiaEsperson GalleryAmerica ChangleHJBroad - Berita & Tren HiburanAyuYogaGuru Gaya Hidup Sehat & Keseimbangan Hidup AlamiAtrapamosBanach Prize Informasi & Tren Terbaru di Dunia GameMcGeeCo Jewelry Berita & Tren Hiburan TerbaruSewdat Info Game Online & Tips Hiburan DigitalCryptnews Plaform Berita Digital TerkiniMukurtu Situs Sejarah DigitalAtlas Flora Pyrenaea Panduan Travel Alam PyreneesSentral Berita - Portal Berita Digital TerkiniBerita Terkini Untuk Masa KiniLangkah Jejak BeritaOgro NewsTempat Berita TerkiniTempatnya Berita Ter UpdateBerita Kekinian Milenialthenytimesnews - Berita Terkini yang KekinianAmbamali CanadaOpen Ether PadOregon Farm Garden NewsThe Poisoned PawnPrediksi shiotogel4dLocanda della Maria Newsinformasi dan dampak sosial duniaViral Pulse GlobalWe Want Real Newspublicflashesfriwebteknologisnowticaambamalicanadacentrethoughtrasindogroupresistancemanualpullippassionwewantrealnewsindonesiareclaimedteakswiftkennedyandcomypassionforthelateshowgardensgishpuppygalleonnewsonlinemagazine-life24hnewspaperunlocksamsungonlineindojastipindonesiaberceritakulinerindobesteeshopsmon-breakindoakarabaditribunwartaoneshottacticalsokpatenduniadalamceritaterkiniberitaliputanmedialintascakrawalakabarduniajejakpagifanatik filmTrending topik terkinicrypto hari iniberita terbaru terupdatepenggemar sepak bolaraja makanangame pc terbaikmodif otomotif tergilaberita olahraga indonesialifestyle terkiniPreston Precious Kehidupan GamersMediaZoneJa Portal Berita UpdateSummitSoftLogo - Inspirasi Logo TerupdateAnimesue - Portal Berita Anime TerlengkapAlbany House Rent - Portal Berita RumahFiji Industries Supplier SemenThe Tremendous Tech Amazing Tips and TrickPitLaneMag - Portal Berita Balap dan OtomotifPanduan Utama Pemasaran Online untuk Pelatih Bola BasketDk Fashion Hub - Fashion Update TerbaruPortal Berita Bola TerbaruPortal Berita Olahraga HarianmuInfo Musik TerviralTempat Cafe Paling Viral KekinianUpdate Pengetahuan Umum TerkiniStyleyug Akses Kesehatan Up to DateBerita Teknologi RumahAkses Pendidikan Terkini saat iniPortal Berita Anda Tips dan Trick RomantisPortal Game paling SerubeuresultvibeconvertertotoyoungkosarkakareembastudiosinfoduniawiportalterkinitribunwisataportaltribunkompasasiaBursa Saham GlobalTips Sehat dan Aktivitas Fisik panduan wisata kuliner dan destinasiTeknologi Otomotif TerbaruBerita Selebriti dan KulinerBerita Olahraga TerbaruBerita Olahraga Dunia TerlengkapUpdate Otomotif TerkiniInfo Terbaru Dunia GameKumpulan Resep MasakanBerita OtomotifEksplorasi Wisata SeruGaya Hidup SehatKuliner ViralYork Teaching StudioStraw BeritaBKS - Berita Kita SemuaAFeliz Cumple Anos NewsNH323 TerkiniDel Carmens Pizza West Food BlogDGTLimoOnieMaruMUKAPEABaduki CenterZepelin01TVN Sports LivePumpClicHijau MultimediaTang Sport Online0-60 Sport CarsBerita FKIP UNEJHarian BEM AmikomScary Short Stories WorldFossil Rock MediaSignaturebar GrantsJakarta In FramePelita iDigitalStreaming XXIBuscaGJok Mobil PadiSearch My MovieGet ADISignature TitlesNides CarAsia 24 NewsAres JournalThe Hungarian QuarterlyPediatric Endosurgery GroupManado BisnisGalgotia PublicationsLes Privat JakartaKikay KitsCheck BiographyGateway GroundsHannah On The MapHiphop Music PlugIndo CulinaryWisdoms GameParke Green GalleriesBuka Buku ProductionOtomotifpediaOembaAdiyaman PortalNew Info TalkSipitung Village
ransplay7 Kebiasaan Sepele Penyebab Diet GagalTrump May Extend TikTok Sale DeadlineMeta AI Now Wants Access to Your Photo GalleryMissile from Yemen Strikes Israel3 Million Cyberattacks Threaten Internet Users in IndonesiaBeauty Trends Expression Confidence and Sustainable ChoicesAI in the Film IndustryFilm Baru Harry Potter Mustahil DibuatTaylor Swift Pecahkan Rekor Baru di Apple MusicUnlock Your Potential by Waking Up Super EarlyFAA Temporarily Bans DronesFOMO vs FUD Emotions Control the Crypto MarketBitcoin Jadi Ajang Persaingan Baru China vs ASTheo Hernandez Segera Gabung Al Hilal dari AC MilanFamily Offices Adapting to Global Market VolatilityRisk Management TechniquesSynopsis of Danny the Dog On Trans TVAustralia Expels Its Ambassador Iran Threatens RetaliationFormer Chelsea Player Reveals Manchester UnitedDean Huijsen Praises Lamine YamalNasi Tutug Oncom dalam Program Makan Bergizi GratisTragedi Raya Sukabumi Infeksi CacingWorker Was Disappointed After Being Paid in CheesecakeLuxury Afternoon Tea with Mon Thong DurianGerbang Tol Kembali Normal Patroli di Tol JORR-S DiperkuatIndonesia Desak Apple Aplikasi Temu dari App StoreSumur Baru PHE ONWJBank Indonesia Expands QRIS Adoption in BaliIndonesia Opens 100 Free Sekolah Rakyat SchoolsDoctor Shares 5 Lifestyle TipsProtecting South Africa Endangered SandfishIndonesia Probes China Hot Rolled Coil ImportsMengenal Arti Mimpi Selingkuh Lebih DalamPrabowo Ungkap Makna Logo HUT ke 80 Kemerdekaan RI 2025TikTok Matikan Live di IndonesiaJerman Imbau Warganya Tinggalkan Iran4 Healthy Habits That May Accelerate AgingBeautiful Scenery in LimaDisney Rilis Film Baru Hexed Penuh KeajaibanWonderkid Manchester United Bersinar di Tur AsiaAyah Ryu Kintaro Angkat BicaraTren Makanan Organik 2025Tren Pepenode Maxi Doge dan Snorter 2025Kenapa Sidik Jari Setiap Orang BerbedaRealme Pamerkan Smartphone TerbaruDesain Rumah dengan Kanopi Modern 2025Acecraft Rilis ResmiMetal Gear Solid Delta Akhirnya RilisSejarah WRCInfrastruktur BerkelanjutanCara Mencerahkan Wajah Kusam Secara AlamiSejarah WRC10 Cokelat Termahal di Dunia10 Potret Baju Pesta Artis Bertema TradisionalKeamanan Siber di Era DigitalTwitch vs TikTok vs Instagram Mana Lebih EfektifMixing Acapella LiveStatus Strategi dan Harapan Oklahoma City Thunder 2026Ikhwan Arief Resmi sebagai Managing Editor DOAJPengalaman Mengelola JurnalSharing Session RJI SUMUTBig Time Chess Aplikasi Game Penghasil UangAnggota DPR Dukung Bareskrim Berantas Markas Judi OnlinePersib vs Arema FC 2025Raditya Dika Soroti Tren Video PodcastUI Teliti Kasus Tumpahan Minyak PT ValeTron Inc Tambah 110 USD Juta TRX ke TreasuryOutfit Travel 2025Menjaga Cairan Tubuh9 Destinasi Romantis untuk HoneymoonKonten Islami Menghibur dan MencerahkanDuel Panas AL vs NL Series MLB 20257 Minuman Pengganti Kopi